. "FUNCTION: Essential for the control of the cell cycle at the G2/M (mitosis) transition. SUBUNIT: Interacts with the CDK1 protein kinase to form a serine/threonine kinase holoenzyme complex also known as maturation promoting factor (MPF). The cyclin subunit imparts substrate specificity to the complex. DEVELOPMENTAL STAGE: Accumulates steadily during G2 and is abruptly destroyed at mitosis. SIMILARITY: Belongs to the cyclin family. Cyclin AB subfamily. WEB RESOURCE: Name=NIEHS-SNPs; URL=\"http://egp.gs.washington.edu/data/ccnb2/\"; GENE SYNONYMS:CCNB2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 398 AA; 45282 MW; 874466E1DD68A4C4 CRC64;"^^ . . . . . . . "CCNB2_HUMAN"^^ . "CCNB2"^^ . . . . . . . . . "MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKFIAIKNKYASSKLLKISMIPQLNSKAVKDLASPLIGRS"^^ . "G2/mitotic-specific cyclin-B2"^^ .