. "SEQUENCE 284 AA; 30251 MW; 794B07A9E7817939 CRC64;"^^ . "FUNCTION: Transcription activator that binds DNA elements with the consensus sequence 5'-CGGTAATTGG-3'. Binds DNA via its homeobox. Required for normal cell death of enteric neurons in the gastrointestinal tract. Required for normal development of the enteric nervous system, and for proper development of normal motility of the gastrointestinal tract (By similarity). SUBCELLULAR LOCATION: Nucleus (Probable). SIMILARITY: Contains 1 homeobox DNA-binding domain. GENE SYNONYMS:TLX2 HOX11L1 NCX. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . . . . . . . "TLX2_HUMAN"^^ . "TLX2"^^ . "Neural crest homeobox protein"^^ . "Homeobox protein Hox-11L1"^^ . . "MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV"^^ . "T-cell leukemia homeobox protein 2"^^ .