. "FUNCTION: Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy, promoting growth of pubic ligaments and ripening of the cervix. SUBUNIT: Heterodimer of a B chain and an A chain linked by two disulfide bonds. SUBCELLULAR LOCATION: Secreted. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P04090-1; Sequence=Displayed; Name=2; IsoId=P04090-2; Sequence=VSP_002711, VSP_002712; TISSUE SPECIFICITY: Isoform 1 is expressed in the ovary during pregnancy. Also expressed in placenta, decidua and prostate. Isoform 2 is relatively abundant in placenta. It is in much lower abundance in the prostate gland. Not detected in the ovary. SIMILARITY: Belongs to the insulin family. GENE SYNONYMS:RLN2. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 185 AA; 21043 MW; AC73DBDE2090091B CRC64;"^^ . . . . . . . . . "REL2_HUMAN"^^ . "RLN2"^^ . "Relaxin B chain"^^ . "Relaxin A chain"^^ . . . "MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVAEIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEAADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC"^^ . "Prorelaxin H2"^^ . . . .