. "FUNCTION: Transcriptional repressor that binds to the promoter region of target genes. Plays a role in the regulation of the cell cycle and of the Wnt pathway. Binds preferentially to the sequence 5'-TTCATTCATTCA-3'. Binding to the H1F0 promoter is enhanced by interaction with RB1. Disrupts the interaction between DNA and TCF4. SUBUNIT: Binds the second PAH repeat of SIN3A (By similarity). Binds TCF4 and RB1. SUBCELLULAR LOCATION: Nucleus. ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O60381-1; Sequence=Displayed; Name=2; IsoId=O60381-2; Sequence=VSP_014655; Note=No experimental confirmation available; Name=3; IsoId=O60381-3; Sequence=VSP_014656; SIMILARITY: Contains 1 AXH domain. SIMILARITY: Contains 1 HMG box DNA-binding domain. SEQUENCE CAUTION: Sequence=BAB85059.1; Type=Erroneous initiation; GENE SYNONYMS:HBP1. COPYRIGHT: Protein annotation is derived from the UniProt Consortium (http://www.uniprot.org/). Distributed under the Creative Commons Attribution-NoDerivs License."^^ . "SEQUENCE 514 AA; 57645 MW; 2AFADC995F73A031 CRC64;"^^ . . . . . . . . . . "HBP1_HUMAN"^^ . "HBP1"^^ . "HMG box transcription factor 1"^^ . "High mobility group box transcription factor 1"^^ . . "MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLPELQAVQSDPTQSGMYQLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATSPQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHERANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARAEGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDHPFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFTPMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEERRMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH"^^ . "HMG box-containing protein 1"^^ . . . . . . .